Skip to content
For businesses and institutions in Egypt. We do not sell to individuals or advise on use.
EGY Peptides
Menu
Request a quote
LL-37 5 mg vial, labelled for research use only

LL-37 5 mgBox code LL375

Supplied to order: the delivery date is on your quotation. Nothing is charged when you pre-order.

Pre-order
Research gradePre-order

LL-37 for research laboratories in Egypt

LL-37 is a synthetic 37-amino-acid peptide matching residues 134 to 170 of the human cathelicidin precursor. The name joins its first two residues, both leucine, to its length. EGY Peptides supplies it to order, as a research-grade material, to laboratories and companies in Egypt that pass our buyer checks.

Sold for laboratory research only. Not for human or veterinary use, and not a medicine.

Pre-orderAsk for a quotationWho may buy
Pack
Box of 10 vials
Box codes
LL375
Label
For laboratory research use only. Not for human or veterinary use.

Strengths and codes

Strength per vialCodePackAvailability
5 mgLL375Box of 10 vialsPre-order

Form: freeze-dried (lyophilised) powder in a sealed vial.

This product is supplied to order. A pre-order is a request, not a purchase: we confirm the price and timing first, and nothing is paid before that.

Identity data

NameLL-37
Other nameshuman cathelicidin LL-37
Sequence (three-letter code)Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Sequence (one-letter code)[LL-37, 37 aa]
Chain length37 residues
Molecular formulaC₂₀₅H₃₄₀N₆₀O₅₃
Molecular weight4493 g/mol
Monoisotopic mass4490.5754 Da
CAS number154947-66-7
UniProt entryP49913

Reference values: PubChem CID 16198951. For the material you receive, the batch certificate takes precedence. To check a certificate's mass against the sequence, use our peptide calculator.

What comes with each batch

  • Certificate of analysis from the manufacturer, showing the batch number, the HPLC purity and the identity by mass spectrometry.
  • Batch number and expiry date on the vial, on the box and on the delivery note.
  • Safety data sheet: on request, where the manufacturer issues it.

The certificate for your batch comes with the goods. Each line of a certificate is explained in how to read a certificate of analysis.

Storage on arrival

Keep it at the condition printed on the label. Until the vial is needed, leave it sealed, dry and out of the light. The reasoning is set out in our peptide storage guide.

Ordering in Egypt

  1. Send the codes and quantities through the quote form, with your commercial register and tax card.
  2. Before a first research-grade order, sign the end-use declaration.
  3. We reply with a quotation in USD, valid for 14 days. Payment methods: bank transfer.
  4. We deliver to your laboratory or business address in Egypt, with the certificate and a delivery note.

Orders come from businesses and institutions only. We do not supply individuals, and we give no advice on how any product is used. The full research-grade line

Frequent questions

What can LL-37 be used for?

Laboratory research, as the label states, and nothing more. We do not describe effects or uses in people or animals. Research use only, explained

What is the amino acid sequence of LL-37?

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser ([LL-37, 37 aa]), 37 residues.

Which CAS number does LL-37 have?

CAS 154947-66-7.

Is LL-37 available in Egypt?

Yes, on pre-order, for verified business buyers. This product is supplied to order, and nothing is paid until we confirm the order.

How much does LL-37 cost?

We quote in USD for each order: send the codes and quantities through the quote form.

Do you sell LL-37 to individuals?

No. Only businesses and institutions that pass our checks can order. A company shows its commercial register and tax card, and research products also need a signed end-use declaration.