Strengths and codes
| Strength per vial | Code | Pack | Availability |
|---|---|---|---|
| 0.1 mg | IGF-01 | Box of 10 vials | Pre-order |
| 1 mg | IGF-1 | Box of 10 vials | Pre-order |
Form: freeze-dried (lyophilised) powder in a sealed vial.
Every strength is supplied to order. A pre-order is a request, not a purchase: we confirm the price and timing first, and nothing is paid before that.
Identity data
| Name | IGF-1 LR3 |
| Other names | Long R3 IGF-I, LR3-IGF-1 |
| Sequence (three-letter code) | Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala |
| Sequence (one-letter code) | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Chain length | 83 residues |
| Disulfide bridges | 3 |
| Molecular formula | C₄₀₀H₆₁₉N₁₁₁O₁₁₅S₉ |
| Molecular weight | 9111.45 g/mol |
| Monoisotopic mass | 9105.3487 Da |
| CAS number | 946870-92-4 |
| UniProt entry | P05019 |
Reference values: calculated from the sequence. For the material you receive, the batch certificate takes precedence. To check a certificate's mass against the sequence, use our peptide calculator.
What comes with each batch
- Certificate of analysis from the manufacturer, showing the batch number, the HPLC purity and the identity by mass spectrometry.
- Batch number and expiry date on the vial, on the box and on the delivery note.
- Safety data sheet: on request, where the manufacturer issues it.
The certificate for your batch comes with the goods. Each line of a certificate is explained in how to read a certificate of analysis.
Storage on arrival
Keep it at the condition printed on the label. Until the vial is needed, leave it sealed, dry and out of the light. The reasoning is set out in our peptide storage guide.
Ordering in Egypt
- Send the codes and quantities through the quote form, with your commercial register and tax card.
- Before a first research-grade order, sign the end-use declaration.
- We reply with a quotation in USD, valid for 14 days. Payment methods: bank transfer.
- We deliver to your laboratory or business address in Egypt, with the certificate and a delivery note.
Orders come from businesses and institutions only. We do not supply individuals, and we give no advice on how any product is used. The full research-grade line
Frequent questions
What can IGF-1 LR3 be used for?
Laboratory research, as the label states, and nothing more. We do not describe effects or uses in people or animals. Research use only, explained
What is the amino acid sequence of IGF-1 LR3?
Met-Phe-Pro-Ala-Met-Pro-Leu-Ser-Ser-Leu-Phe-Val-Asn-Gly-Pro-Arg-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala (MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA), 83 residues.
Which CAS number does IGF-1 LR3 have?
CAS 946870-92-4.
Is IGF-1 LR3 available in Egypt?
Yes, on pre-order, for verified business buyers. Every strength is supplied to order, and nothing is paid until we confirm the order.
How much does IGF-1 LR3 cost?
We quote in USD for each order: send the codes and quantities through the quote form.
Do you sell IGF-1 LR3 to individuals?
No. Only businesses and institutions that pass our checks can order. A company shows its commercial register and tax card, and research products also need a signed end-use declaration.